Overview

  • Product name
    Anti-C6orf134/TAT antibody
    See all C6orf134/TAT primary antibodies
  • Description
    Rabbit polyclonal to C6orf134/TAT
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human C6orf134/TAT aa 1-50 (N terminal).
    Sequence:

    MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

  • Positive control
    • HepG2 Cell Lysate IF/ICC: U-87 MG cell line.
  • General notes

     This product was previously labelled as C6orf134

     

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab58742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:1562500.

ICC/IF Use a concentration of 5 µg/ml.

Target

Images

  • ICC/IF image of ab58742 stained U-87 MG cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab58742, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-C6orf134/TAT antibody (ab58742) at 2.5 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa



    Gel concentration: 12%

References

This product has been referenced in:
  • Zeng QZ  et al. Paclitaxel Enhances the Innate Immunity by Promoting NLRP3 Inflammasome Activation in Macrophages. Front Immunol 10:72 (2019). Read more (PubMed: 30761140) »
  • Shifeng L  et al. Ac-SDKP increases a-TAT 1 and promotes the apoptosis in lung fibroblasts and epithelial cells double-stimulated with TGF-ß1 and silica. Toxicol Appl Pharmacol 369:17-29 (2019). Read more (PubMed: 30826375) »
See all 9 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (neurons from mice primary culture)
Gel Running Conditions
Non-reduced Denaturing (10%)
Loading amount
15 µg
Specification
neurons from mice primary culture
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Aug 23 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up