Overview

  • Product name

  • Description

    Rabbit polyclonal to C6ORF182
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C6ORF182 aa 1-167.
    Sequence:

    MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSP NSQALILALKTLQEKIHRLELERTQAEDNLNILSREAAQYKKALENETNE RNLAHQELIKQKKDISIQLSSAQSRCTLLEKQLEYTKRMVLNVEREKNMI LEQQAQLQREKEQDQMK


    Database link: Q8IYX8

  • Positive control

    • WB: CEM, HEK-293T, HeLa, Jurkat and A549 whole cell lysates. IHC-P: Human tonsil and skin tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 46,54 kDa.

Target

  • Relevance

    The exact functions of C6orf182 remain unknown but it is thought to be a centrosomal protein which may be required for microtubule attachment to centrosomes.
  • Cellular localization

    Cytoplasmic; cytoskeleton, microtubule. Centrosome.
  • Database links

  • Alternative names

    • BA487F23.2 antibody
    • Centrosomal protein of 57 kDa-related protein antibody
    • Cep57-related protein antibody
    • CEP57R antibody
    • Chromosome 6 open reading frame 182 antibody
    • Hypothetical protein LOC285753 antibody
    • MGC21731 antibody
    • MGC70837 antibody
    • OTTHUMP00000016948 antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for CEP57L1 using ab229864 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for CEP57L1 using ab229864 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-C6ORF182 antibody (ab229864) at 1/1000 dilution

    Lane 1 : CEM whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 5 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 46,54 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?

References

ab229864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up