Overview

  • Product name

  • Description

    Rabbit polyclonal to C7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat C7 aa 1-144. Expressed in E. coli.
    Sequence:

    EFCPSPPALKDGFVQSEGTMFPIGKNIVYACNEGYSLVGDPVARCGEDLQ WLVGEMHCQKIACFLPGGMNGMRSDPQKPFYMVGEKVTLSCAGGMSLEGP STFLCGSSLKWSPELKSAQCVQKVTSTLTPAAPACQPWEKLQNS


    Database link: Q9ERF0

  • Positive control

    • WB: Recombinant rat C7 protein. Rat serum. IHC-P: Rat intestine, liver, stomach and spinal cord tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor.
  • Involvement in disease

    Defects in C7 are a cause of complement component 7 deficiency (C7D) [MIM:610102]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similarities

    Belongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 2 Sushi (CCP/SCR) domains.
    Contains 2 TSP type-1 domains.
  • Post-translational
    modifications

    C7 has 28 disulfide bridges.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C7 antibody
    • CO7_HUMAN antibody
    • complement component 7 antibody
    • Complement component C7 antibody

Images

  • Anti-C7 antibody (ab231047) at 2 µg/ml + Rat serum

    Secondary
    HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded rat intestine tissue stained for C7 with ab231047 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for C7 with ab231047 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for C7 with ab231047 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for C7 with ab231047 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-C7 antibody (ab231047) at 2 µg/ml + Recombinant rat C7 protein

    Developed using the ECL technique.

References

ab231047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up