Overview

  • Product name

    Anti-C7orf34 antibody
  • Description

    Rabbit polyclonal to C7orf34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human C7orf34 aa 29-122. Full length mature chain without signal peptide.
    Sequence:

    SPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSS KTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH


    Database link: Q96L11-1

  • Positive control

    • WB: K562 whole cell lysate. IHC-P: Human liver cancer and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

Images

  • Anti-C7orf34 antibody (ab235542) at 1/1000 dilution + K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human liver cancer tissue stained for C7orf34 with ab235542 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for C7orf34 with ab235542 (1/100 dilution) in immunohistochemical analysis.

References

ab235542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up