Anti-TTI2 antibody - C-terminal (ab176698)
Key features and details
- Rabbit polyclonal to TTI2 - C-terminal
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TTI2 antibody - C-terminal
See all TTI2 primary antibodies -
Description
Rabbit polyclonal to TTI2 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human TTI2 aa 458-508 (C terminal). The exact sequence is proprietary. (NP_079391.2).
Sequence:ATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVVNYIRKVQQVSEGAPYN
Database link: Q6NXR4 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176698 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 57 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 80185 Human
- Omim: 614426 Human
- SwissProt: Q6NXR4 Human
- Unigene: 583805 Human
-
Alternative names
- C8orf41 antibody
- CH041_HUMAN antibody
- TELO2 interacting protein 2provided antibody
see all
Images
-
All lanes : Anti-TTI2 antibody - C-terminal (ab176698) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 minutes -
Immunoprecipitation. ab176698 at 1 µg/ml staining TTI2 in HeLa whole cell lysate immunoprecipitated using ab176698 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
Lane 2: control IgG.
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab176698 has not yet been referenced specifically in any publications.