Overview

  • Product name

  • Description

    Guinea pig polyclonal to C9
  • Host species

    Guinea pig
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rabbit
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rabbit C9 aa 139-519. (Expressed in E.coli).
    Sequence:

    PRLTCRNREVQESELARTAGYGINILGMDPLATPFDNEYYHGLCDRVWDG NTLTHYRKPWNVAVLAYETKIDKNFRTEYYEEQMQAFKSIIEEETSNFNA NLALKFTPTEAKASKAEEASPKNKSLDDNDKGFSSKFQFSYSKNETYQLF LSYSSQKEKMFLLVKGIIQLGRFVMKNRGVMLTNTFLDDIKSLPTTYEKG EYFAFLETYGTHYSSSGSLGGRYELIYVLDKASMKEKGIELNDIKKCLGF DLDLSLNIPGKSAGLSLTGQANKNNCLKSGHGNAVNITRANLIDDVISLI RGGTQKFAFELKEKLLTKAKMVDVTDFINWASSLSDAPVLINQKLSPIYN LIPVKIKDAHQKRQNLERGIEDYINEFSTKK


    Database link: P48747

  • Positive control

    • IHC-P: Rabbit liver tissue. WB: Rabbit kidney and heart lysates; Recombinant rabbit C9 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232687 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab232687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Function

    Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Defects in C9 are a cause of complement component 9 deficiency (C9D) [MIM:613825]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similarities

    Belongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 1 TSP type-1 domain.
  • Post-translational
    modifications

    Thrombin cleaves factor C9 to produce C9a and C9b.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted. Cell membrane. Secreted as soluble monomer. Oligomerizes at target membranes, forming a pre-pore. A conformation change then leads to the formation of a 100 Angstrom diameter pore.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARMD15 antibody
    • C9 antibody
    • C9 deficiency antibody
    • C9 deficiency with dermatomyositis antibody
    • C9D antibody
    • CO9_HUMAN antibody
    • Complement component 9 antibody
    • Complement component 9 deficiency antibody
    • Complement component C9 antibody
    • Complement component C9b antibody
    see all

Images

  • Paraffin-embedded rabbit liver tissue stained for C9 using ab232687 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-C9 antibody (ab232687) at 2 µg/ml + Recombinant rabbit C9 protein

    Predicted band size: 63 kDa

  • All lanes : Anti-C9 antibody (ab232687) at 2 µg/ml

    Lane 1 : Rabbit kidney lysate
    Lane 2 : Rabbit heart lysate

    Predicted band size: 63 kDa

References

ab232687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up