Overview

  • Product name

    Anti-C9orf169 antibody
  • Description

    Rabbit polyclonal to C9orf169
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C9orf169 aa 77-144.
    Sequence:

    PIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHC CHCPPFCRCHSCCCCVIS


    Database link: A8MQ03

  • Positive control

    • Human esophagus tissue
      Over-expression HEK293T cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

Images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleus but not nucleoli and vesicles. Recommended concentration of ab121701 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121701, at a 1/225 dilution, staining C9orf169 in paraffin-embedded Human esophagus tissue by Immunohistochemistry.
  • All lanes : Anti-C9orf169 antibody (ab121701) at 1/250 dilution

    Lane 1 : Blank vector transfected HEK293T cell lysate
    Lane 2 : Over-expression HEK293T cell lysate, with a C terminal myc-DDK tag

References

ab121701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up