Overview

  • Product name

  • Description

    Rabbit polyclonal to C9orf23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human C9orf23 aa 1-163.
    Sequence:

    MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGG SARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPAS PDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSC GPRSRRRARDTRS


    Database link: Q8N5L8

  • Positive control

    • WB: Mouse heart lysate. IHC-P: Human adrenal gland and prostate cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 18 kDa.

Target

  • Relevance

    May be a component of ribonuclease P or MRP.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Alba like protein C9orf23 antibody
    • bA296L22.5 antibody
    • C9orf23 antibody
    • MGC29635 antibody
    • Ribonuclease P protein subunit p25 like protein antibody
    • Ribonuclease P/MRP 25kDa subunit like antibody
    • RNase P protein subunit like p25 antibody
    • Rpp25 like protein antibody
    • RPP25L antibody
    see all

Images

  • Anti-C9orf23 antibody (ab230389) at 1/1000 dilution + Mouse heart lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 18 kDa

  • Paraffin-embedded human adrenal gland tissue stained for C9orf23 using ab230389 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for C9orf23 using ab230389 at 1/100 dilution in immunohistochemical analysis.

References

ab230389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up