Overview

  • Product name

    Anti-C9orf30 antibody
  • Description

    Rabbit polyclonal to C9orf30
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human C9orf30 aa 215-275.
    Sequence:

    MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPV SSFNRPFPNSP


    Database link: Q96H12

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    The function of this protein remains unknown.
  • Database links

  • Alternative names

    • Chromosome 9 open reading frame 30 antibody
    • CI030 antibody
    • FLJ34973 antibody
    • Hypothetical protein LOC91283 antibody
    • L8 antibody
    • MGC17337 antibody
    • Myb/SANT like DNA binding domain containing protein 3 antibody
    • OTTHUMP00000021792 antibody
    • UPF0439 protein C9orf30 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RH-30 cells stained for C9orf30 (green) using ab222239 at 4 µg/ml in ICC/IF.

References

ab222239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up