Overview

  • Product name

    Anti-C9ORF46/PLGRKT antibody
    See all C9ORF46/PLGRKT primary antibodies
  • Description

    Rabbit polyclonal to C9ORF46/PLGRKT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human C9ORF46/PLGRKT aa 1-147.
    Sequence:

    MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWS REFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYG TLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK


    Database link: Q9HBL7

  • Positive control

    • WB: A431, NIH/3T3 and U-251 MG whole cell lysates; Mouse lung tissue lysate. IHC-P: Human colon cancer and skin tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as C9ORF46

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9.
  • Tissue specificity

    Expressed in peripheral blood cells and monocytes. Expressed in adrenal medulla.
  • Cellular localization

    Cell membrane. Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/PLAUR.
  • Information by UniProt
  • Database links

  • Alternative names

    • AD025 antibody
    • Chromosome 9 open reading frame 46 antibody
    • FLJ14688 antibody
    • FLJ39176 antibody
    • Hypothetical protein LOC55848 antibody
    • MDS030 antibody
    • Plasminogen receptor (KT) antibody
    • Plg-R(KT) antibody
    • PLGRKT antibody
    • PLRKT_HUMAN antibody
    • transmembrane protein C9orf46 antibody
    • Uncharacterized hematopoietic stem/progenitor cells protein MDS030 antibody
    see all

Images

  • All lanes : Anti-C9ORF46/PLGRKT antibody (ab237525) at 1/500 dilution

    Lane 1 : A431 (Human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : NIH/3T3 (Mouse embryo fibroblast cell line) whole cell lysate
    Lane 4 : U-251 MG (Human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 17 kDa

  • Paraffin-embedded human colon cancer tissue stained for C9ORF46/PLGRKT using ab237525 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for C9ORF46/PLGRKT using ab237525 at 1/100 dilution in immunohistochemical analysis.

  • U-251 MG (Human brain glioma cell line) cells stained for C9ORF46/PLGRKT (green) using ab237525 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up