Overview

  • Product name

  • Description

    Rabbit polyclonal to C9orf64
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human C9orf64 aa 255-340.
    Sequence:

    SDDLLKKLLKGEMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKP NGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIY


    Database link: Q5T6V5

  • Positive control

    • WB: RT4 (human urinary bladder cancer cell line) and U-251 MG (human brain glioma cell line) whole cell lysate; human liver and tonsil tissue lysate. ICC/IF: RH-30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 39 kDa.

Target

Images

  • All lanes : Anti-C9orf64 antibody (ab222034) at 1/100 dilution

    Lane 1 : RT4 whole cell lysate
    Lane 2 : U-251 MG whole cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 39 kDa

  • RH-30 cells stained for C9orf64 (green) using ab222034 (4 µg/ml) in immunocytochemistry/ immunofluorescence.

References

ab222034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up