Overview

  • Product name

  • Description

    Rabbit polyclonal to CA150
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CA150 aa 724-817.
    Sequence:

    KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALF NEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV


    Database link: O14776

  • Positive control

    • Human cerebral cortex tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcription factor that binds RNA polymerase II and inhibits the elongation of transcripts from target promoters. Regulates transcription elongation in a TATA box-dependent manner. Necessary for TAT-dependent activation of the human immunodeficiency virus type 1 (HIV-1) promoter.
  • Tissue specificity

    Detected in brain neurons.
  • Sequence similarities

    Contains 6 FF domains.
    Contains 3 WW domains.
  • Domain

    The FF domains bind the phosphorylated C-terminus of the largest subunit of RNA polymerase II, probably mediate interaction with HTATSF1 and preferentially bind peptides with the consensus sequence [DE](2-5)-[FWY]-[DE](2-5).
    The WW domains bind Pro-rich domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CA 150 antibody
    • Co activator of 150 kDa antibody
    • Coactivator of 150 kDa antibody
    • MGC133200 antibody
    • TAF 2S antibody
    • TAF2S antibody
    • TATA box binding protein (TBP) associated factor RNA polymerase II S 150kD antibody
    • TATA box binding protein associated factor 2S antibody
    • TATA box binding protein associated factor RNA polymerase II S 150kD antibody
    • TATA box-binding protein-associated factor 2S antibody
    • TBP-associated factor, RNA polymerase II, 150-kD antibody
    • TCERG 1 antibody
    • TCERG1 antibody
    • TCRG1_HUMAN antibody
    • Transcription elongation regulator 1 antibody
    • Transcription factor CA 150 antibody
    • Transcription factor CA150 antibody
    • Urn1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling CA150 with ab204781 at 1/500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling CA150 with ab204781 at 4 µg/ml (green).

References

ab204781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up