Anti-CABCOCO1 antibody (ab122716)
Key features and details
- Rabbit polyclonal to CABCOCO1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CABCOCO1 antibody -
Description
Rabbit polyclonal to CABCOCO1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CABCOCO1 aa 135-203.
Sequence:EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQ TEINEKLQIQEEAFNARIE
-
Positive control
- IHC-P: Human placenta and fallopian tube tissue
-
General notes
ab122716 is mono-specific.
This product was previously labelled as C10orf107
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Primary antibody notes
ab122716 is mono-specific. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab122716 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 219621 Human
- SwissProt: Q8IVU9 Human
- Unigene: 673160 Human
-
Alternative names
- bA63A2.1 antibody
- C10orf107 antibody
- Chromosome 10 open reading frame 107 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CABCOCO1 antibody (ab122716)
ab122716, at 1/200 dilution, staining CABCOCO1 in paraffin-embedded Human fallopian tube tissue by Immunohistochemistry.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CABCOCO1 antibody (ab122716)
ab122716, at 1/200 dilution, staining CABCOCO1 in paraffin-embedded Human prostate tissue by Immunohistochemistry. This image shows low expression as expected.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CABCOCO1 antibody (ab122716)
ab122716, at 1/200 dilution, staining CABCOCO1 in paraffin-embedded Human placenta tissue by Immunohistochemistry.
Protocols
Datasheets and documents
References (0)
ab122716 has not yet been referenced specifically in any publications.