Description

  • Product name

    CACHD1 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
    • Predicted molecular weight

      137 kDa

Specifications

Our Abpromise guarantee covers the use of ab106724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names

    • CACHD1
    • Cache domain containing protein 1
    • Cache domain-containing protein 1
    • CAHD1_HUMAN
    • von Willebrand factor type A and cache domain containing 1
    • VWCD1
    • VWFA and cache domain-containing protein 1
    see all
  • Function

    May regulate voltage-dependent calcium channels.
  • Sequence similarities

    Belongs to the calcium channel subunit alpha-2/delta family.
    Contains 2 cache domains.
    Contains 1 VWFA domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab106724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up