Overview

  • Product name

  • Description

    Rabbit polyclonal to CACNA1G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CACNA1G aa 889-939 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    CKFASERDGDTLPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSS W


    Database link: O43497

  • Positive control

    • Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab203577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Relevance

    Voltage activated calcium channels can be distinguished based on their voltage dependence, deactivation, and single channel conductance. Low voltage activated calcium channels are referred to as 'T' type because their currents are both transient, owing to fast inactivation, and tiny, owing to small conductance. T type channels are thought to be involved in pacemaker activity, low threshold calcium spikes, neuronal oscillations and resonance, and rebound burst firing.
  • Cellular localization

    Membrane; Multipass membrane protein.
  • Database links

  • Alternative names

    • calcium channel voltage dependent alpha 1G subunit antibody
    • calcium channel voltage dependent T type alpha 1G subunit antibody
    • calcium channel voltage dependent T type alpha1G subunit antibody
    • CaV T1 antibody
    • Cav3 1 antibody
    • cav3 1c antibody
    • KIAA1123 antibody
    • MGC117234 antibody
    • NBR13 antibody
    • voltage dependent calcium channel alpha 1G subunit isoform 11 antibody
    • voltage dependent T type calcium channel subunit alpha 1G antibody
    • Voltage gated calcium channel subunit alpha Cav3 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling CACNA1G with ab203577 at 1/200 dilution. The secondary antibody was Goat Anti-Rabbit IgG, Cy3 conjugated used at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling CACNA1G with ab203577 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Chen J  et al. Roles and mechanisms of TRPC3 and the PLC?/PKC/CPI-17 signaling pathway in regulating parturition. Mol Med Rep 17:898-910 (2018). Read more (PubMed: 29115500) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up