Overview

  • Product name

  • Description

    Rabbit polyclonal to CACNA2D2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CACNA2D2 aa 1048-1129.
    Sequence:

    TNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHI CFDYNATEDTSDCGRGASFPPSLGVLVSLQLL


    Database link: Q9NY47

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) and possibly T-type (CACNA1G). Overexpression induces apoptosis.
  • Tissue specificity

    Predominantly present in cerebellar cortex. Present in various lung tumor cell lines, while it is absent in normal lung (at protein level). Highly expressed in heart, lung, testis, pancreas and skeletal muscle. Also expressed in kidney, liver, placenta and brain.
  • Sequence similarities

    Belongs to the calcium channel subunit alpha-2/delta family.
    Contains 1 cache domain.
    Contains 1 VWFA domain.
  • Domain

    The MIDAS-like motif in the VWFA domain binds divalent metal cations and is required to promote trafficking of the alpha-1 (CACNA1) subunit to the plasma membrane by an integrin-like switch.
  • Post-translational
    modifications

    May be proteolytically processed into subunits alpha-2-2 and delta-2 that are disulfide-linked. It is however unclear whether such cleavage really takes place in vivo and has a functional role.
  • Cellular localization

    Membrane. Colocalizes with CACNA1A in lipid raft fractions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha 2 delta calcium channel subunit antibody
    • CA2D2_HUMAN antibody
    • CACNA2D antibody
    • Cacna2d2 antibody
    • Calcium channel, voltage-dependent, alpha 2/delta subunit 2 antibody
    • Calcium channel, voltage-dependent, alpha 2/delta subunit 2 gene 26 antibody
    • Calcium voltage gated channel auxiliary subunit alpha2delta 2 antibody
    • Gene 26 antibody
    • KIAA0558 antibody
    • LUAC11.1 antibody
    • Voltage-dependent calcium channel subunit alpha-2/delta-2 antibody
    • Voltage-dependent calcium channel subunit delta-2 antibody
    • Voltage-gated calcium channel subunit alpha-2/delta-2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for CACNA2D2 (green) using ab221865 at 4 µg/ml in ICC/IF.

References

ab221865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up