Overview

  • Product name

  • Description

    Rabbit polyclonal to CACNB1/CAB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human CACNB1/CAB1 aa 429-598.
    Sequence:

    ATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGL YPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSE GPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGG PVLGRNKNELEGWGRGVYIR


    Database link: Q02641-1

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human brain and kidney tissues.
  • General notes

    Previously labelled as CACNB1.

Properties

Applications

Our Abpromise guarantee covers the use of ab230033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 66 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
  • Tissue specificity

    Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
  • Sequence similarities

    Belongs to the calcium channel beta subunit family.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell membrane > sarcolemma.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAB1 antibody
    • CACB1_HUMAN antibody
    • CACNB1 antibody
    • CACNLB1 antibody
    • Calcium channel L type beta 1 polypeptide antibody
    • Calcium channel voltage dependent beta 1 subunit antibody
    • Calcium channel voltage-dependent subunit beta 1 antibody
    • CCHLB1 antibody
    • Dihydropyridine sensitive L type calcium channel beta 1 subunit antibody
    • MGC41896 antibody
    • Voltage dependent L type calcium channel beta 1 subunit antibody
    • Voltage-dependent L-type calcium channel subunit beta-1 antibody
    see all

Images

  • Anti-CACNB1/CAB1 antibody (ab230033) at 1/1000 dilution + HepG2 (human liver hepatocellular carcioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 66 kDa
    Observed band size: 66 kDa

  • Paraffin-embedded human brain tissue stained for CACNB1/CAB1 using ab230033 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for CACNB1/CAB1 using ab230033 at 1/100 dilution in immunohistochemical analysis.

References

ab230033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up