Overview

  • Product name

  • Description

    Rabbit polyclonal to CACNG6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CACNG6 aa 66-134.
    Sequence:

    NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCT YFKFFTTGENARIFQRTTK


    Database link: Q9BXT2

  • Positive control

    • ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
  • Cellular localization

    Plasma membrane
  • Database links

  • Alternative names

    • Calcium channel voltage dependent gamma subunit 6 antibody
    • Neuronal voltage gated calcium channel gamma 6 subunit antibody
    • Voltage-dependent calcium channel gamma-6 subunit antibody

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling CACNG6 with ab220833 at 4 µg/mL (green).

References

ab220833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up