Overview

  • Product name

    Anti-CACNG7 antibody
  • Description

    Rabbit polyclonal to CACNG7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CACNG7 aa 156-275.
    Sequence:

    INDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYA EEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMT QNYPPAIKYPDHLHISTSPC


    Database link: P62955

  • Positive control

    • IHC-P: Human liver cancer and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Thought to stabilize the calcium channel in an inactivated (closed) state.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CACNG 7 antibody
    • Cacng7 antibody
    • Calcium channel voltage dependent gamma subunit 7 antibody
    • CCG7_HUMAN antibody
    • Neuronal voltage gated calcium channel gamma 7 subunit antibody
    • Neuronal voltage-gated calcium channel gamma-7 subunit antibody
    • OTTHUMP00000067298 antibody
    • OTTHUMP00000067299 antibody
    • OTTHUMP00000197715 antibody
    • TARP gamma 7 antibody
    • Transmembrane AMPAR regulatory protein gamma 7 antibody
    • Voltage dependent calcium channel gamma 7 subunit antibody
    • Voltage-dependent calcium channel gamma-7 subunit antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for CACNG7 using ab230182 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for CACNG7 using ab230182 at 1/100 dilution in immunohistochemical analysis.

References

ab230182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up