Overview

  • Product name

    Anti-Cactin antibody
  • Description

    Rabbit polyclonal to Cactin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cactin aa 320-521.
    Sequence:

    DDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYMELEQGKNADFWRDMTTI TEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQ GIEGKIRAGGPNLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLK QEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDG AT


    Database link: Q8WUQ7

  • Positive control

    • HCT-116 lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab208289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 4 µg/ml. Predicted molecular weight: 89 kDa.

Target

  • Function

    May be involved in pre-mRNA splicing.
  • Information by UniProt
  • Database links

  • Alternative names

    • C19orf29 antibody
    • Cactin antibody
    • CS029_HUMAN antibody
    • FLJ17482 antibody
    • FLJ59622 antibody
    • fSAPc antibody
    • Functional spliceosome associated protein c antibody
    • NY REN 24 antibody
    • NY REN 24 antigen antibody
    • Renal carcinoma antigen NY-REN-24 antibody
    • Uncharacterized protein C19orf29 antibody
    see all

Images

  • Anti-Cactin antibody (ab208289) at 4 µg/ml + HCT-116 lysate

    Predicted band size: 89 kDa

References

ab208289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up