Overview

  • Product name

  • Description

    Rabbit polyclonal to CacyBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CacyBP aa 2-228. Expressed in E.coli. N-terminal tags.
    Sequence:

    ASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKK AELLDNEKPAAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPT ENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVL ILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYED GDDDMKRTINKAWVESREKQAKGDTEF


    Database link: Q9HB71-1

  • Positive control

    • WB: Recombinant human CacyBP; Pig brain lysate; HeLa and A431 cell lysates. IHC-P: Human liver, prostate, kidney, stomach, cerebrum and prostate cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as SIAH Interacting Protein

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be involved in calcium-dependent ubiquitination and subsequent proteasomal degradation of target proteins. Probably serves as a molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1).
  • Sequence similarities

    Contains 1 CS domain.
    Contains 1 SGS domain.
  • Post-translational
    modifications

    Phosphorylated on serine residues. Phosphorylated upon induction by RA or at high calcium concentrations.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasmic at low calcium concentrations. In neuroblastoma cells, after a retinoic acid (RA) induction and calcium increase, it localizes in both the nucleus and cytoplasm. The nuclear fraction may be phosphorylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • CacyBP antibody
    • Calcyclin binding protein antibody
    • Calcyclin-binding protein antibody
    • CYBP_HUMAN antibody
    • GIG 5 antibody
    • GIG5 antibody
    • Growth inhibiting gene 5 antibody
    • Growth inhibiting gene 5 protein antibody
    • hCacyBP antibody
    • MGC87971 antibody
    • PNAS 107 antibody
    • PNAS107 antibody
    • RP1 102G20.6 antibody
    • S100A6 binding protein antibody
    • S100A6-binding protein antibody
    • S100A6BP antibody
    • Siah-interacting protein antibody
    • SIP antibody
    see all

Images

  • All lanes : Anti-CacyBP antibody (ab232955) at 3 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for CacyBP (green) using ab232955 at 20 μg/ml in ICC/IF. FITC labeling.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for CacyBP using ab232955 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-CacyBP antibody (ab232955) at 3 µg/ml + Recombinant human CacyBP

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

References

ab232955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up