Overview

  • Product name

  • Description

    Rabbit polyclonal to cadherin 10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Chicken, Human
  • Immunogen

    Recombinant fragment corresponding to Human cadherin 10 aa 20-260.
    Sequence:

    CSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQFFLLEEYTG SDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDR EEKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASV PEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIR TALPNMNRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLT


    Database link: Q9Y6N8

  • Positive control

    • WB: Rat heart tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab230309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 88 kDa (predicted molecular weight: 88 kDa).

Target

  • Function

    Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Predominantly expressed in brain. Also found in adult and fetal kidney. Very low levels detected in prostate and fetal lung.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Domain

    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAD10_HUMAN antibody
    • Cadherin 10 (T2 cadherin) antibody
    • Cadherin 10 type 2 (T2 cadherin) antibody
    • Cadherin 10 type 2 antibody
    • Cadherin-10 antibody
    • Cadherin10 antibody
    • CDH10 antibody
    • T2 cadherin antibody
    • T2-cadherin antibody
    see all

Images

  • Anti-cadherin 10 antibody (ab230309) at 1/1000 dilution + Rat heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 88 kDa
    Observed band size: 88 kDa

References

ab230309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up