Overview

  • Product name
  • Description
    Rabbit polyclonal to Cadherin 16
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Cadherin 16 aa 151-200 (N terminal).
    Sequence:

    SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD

  • Positive control
    • Human fetal brain lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab80320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
ICC/IF Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 90 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

Target

Images

  • ab80320 staining Cadherin 16 human kidney cells (RPTEC/TERT1) by Immunocytochemistry/ Immunofluorescence.
    Cells were fixed in methanol, blocked using 5 % BSA, 1 % Triton X-100 for 1 hour at 25°C and then incubated with ab80320 at a 1/100 dilution for 14 hours at 4°C. The secondary used was an Alexa-Fluor 488 conjugated donkey anti-rabbit polyclonal used at a 1/800 dilution.

    See Abreview

  • Anti-Cadherin 16 antibody (ab80320) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 90 kDa
    Observed band size: 92 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling Cadherin 16 with ab80320 at 5µg/ml.

References

This product has been referenced in:
  • Aschauer L  et al. Delineation of the key aspects in the regulation of epithelial monolayer formation. Mol Cell Biol 33:2535-50 (2013). Read more (PubMed: 23608536) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Cow Tissue lysate - whole (Kidney)
Gel Running Conditions
Reduced Denaturing (10)
Loading amount
10 µg
Specification
Kidney
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Oct 07 2016

Answer

Thank you for contacting us.

I have added the code and published your review. We are happy that this product worked well for you in this application. Thank you very much for participating in our 100% Abreview testing program.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Kidney (RPTEC/TERT1))
Specification
Kidney (RPTEC/TERT1)
Fixative
Methanol
Permeabilization
No
Blocking step
5 % BSA, 1 % Triton X-100 as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 15 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up