Overview

  • Product name

  • Description

    Rabbit polyclonal to Cadherin 8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Cadherin 8 aa 653-782.
    Sequence:

    IIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDIKP DLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYEGR GSVAGSLSSLESTTSDSDQNFDYLSDWGPR


    Database link: P55286

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells labeling Cadherin 8 (green) using ab234839 at 1/100 dilution in ICC/IF. Alexa Fluor®  488-conjugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

References

ab234839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up