Overview

  • Product name

    Anti-CALCB antibody
  • Description

    Rabbit polyclonal to CALCB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Rat CALCB aa 1-134. (Expressed in E.coli).
    Sequence:

    MDFWKFFPFLALSSMWVLCLASSLQAAPFRSALESSLDLGTLSDQEKHLL LAALIQDYEQKARKLEQEEQETEGSRKGSSSSVISQKRSCNTATCVTHRL AGLLRRSGGVVKDNFVPTNVGSKAFGRRRRDLRV


    Database link: P10093

  • Positive control

    • WB: Rat serum; Recombinant rat CALCB protein. IHC-P: Rat liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231662 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
  • Sequence similarities

    Belongs to the calcitonin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta type CGRP antibody
    • Beta-CGRP antibody
    • Beta-type CGRP antibody
    • CALC2 antibody
    • Calcb antibody
    • CALCB_HUMAN antibody
    • Calcitonin gene related peptide 2 antibody
    • Calcitonin gene related peptide II antibody
    • Calcitonin gene-related peptide 2 antibody
    • Calcitonin gene-related peptide II antibody
    • Calcitonin related polypeptide, beta antibody
    • CGRP II antibody
    • CGRP-II antibody
    • CGRP2 antibody
    • CGRPII antibody
    • FLJ30166 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for CALCB using ab231662 at 20 µg/ml in immunohistochemical analysis.

  • Anti-CALCB antibody (ab231662) at 2 µg/ml + Rat serum

    Predicted band size: 15 kDa

  • Anti-CALCB antibody (ab231662) at 2 µg/ml + Recombinant rat CALCB protein

    Predicted band size: 15 kDa

References

ab231662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up