Overview

  • Product name
    Calcicludine
  • Description
    Potent, selective L-type Ca2+ channel blocker
  • Biological description
    Potent, selective L-type Ca2+ channel blocker (EC50 values are 0.2 and 1-5 nM for L-type and P-type respectively). Active in vivo.
  • Purity
    > 98%

Properties

  • Molecular weight
    6979.00
  • Chemical structure
    Chemical Structure
  • Molecular formula
    C321H476N86O78S6
  • CAS Number
    178037-96-2
  • Sequence
    WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK (Modifications: Disulfide bonds: 7-57, 16-40, 32-53)
  • Storage instructions
    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview
    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:
  • Wang X  et al. Calcicludine binding to the outer pore of L-type calcium channels is allosterically coupled to dihydropyridine binding. Biochemistry 46:7590-8 (2007). Read more (PubMed: 17536837) »
  • Stotz SC  et al. Block of voltage-dependent calcium channel by the green mamba toxin calcicludine. J Membr Biol 174:157-65 (2000). Read more (PubMed: 10742459) »
  • Nishio H  et al. Structure-activity relationships of calcicludine and dendrotoxin-I, homologous peptides acting on different targets, calcium and potassium channels. Biochem Biophys Res Commun 262:319-21 (1999). Read more (PubMed: 10462472) »
  • Schweitz H  et al. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons. Proc Natl Acad Sci U S A 91:878-82 (1994). Read more (PubMed: 8302860) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE, NOT FOR USE IN HUMANS"

Sign up