Overview

  • Product name

    Anti-Calcineurin B/CNB antibody
    See all Calcineurin B/CNB primary antibodies
  • Description

    Rabbit polyclonal to Calcineurin B/CNB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Calcineurin B/CNB aa 11-170.
    Sequence:

    EMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVI DIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISN GELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGG LDIHKKMVVDV


    Database link: P63098

  • Positive control

    • WB: SH-SY5Y, SW480, HL-60 and MCF7 cell extracts; mouse brain, spleen and lung cell extracts; rat brain and testis cell extracts. IHC-P: Human brain cortex tissue.
  • General notes

     This product was previously labelled as Calcineurin B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB 1/500 - 1/2000. Predicted molecular weight: 19 kDa.

Target

  • Function

    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similarities

    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha isoform (calcineurin B, type I) antibody
    • calcineurin B, type I (19kDa) antibody
    • Calcineurin subunit B type 1 antibody
    • CALNB1 antibody
    • CANB1_HUMAN antibody
    • Cna2 antibody
    • CNB antibody
    • CNB1 antibody
    • OTTHUMP00000201960 antibody
    • OTTHUMP00000201961 antibody
    • Ppp3r1 antibody
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform antibody
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform antibody
    • Protein phosphatase 2B regulatory subunit 1 antibody
    • Protein phosphatase 2B regulatory subunit B alpha antibody
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 regulatory subunit B alpha antibody
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1 antibody
    see all

Images

  • All lanes : Anti-Calcineurin B/CNB antibody (ab230899) at 1/500 dilution

    Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) cell extract
    Lane 2 : SW480 (human colorectal adenocarcinoma cell line) cell extract
    Lane 3 : HL-60 (human promyelocytic leukemia cell line) cell extract
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) cell extract
    Lane 5 : Mouse brain cell extract
    Lane 6 : Mouse spleen cell extract
    Lane 7 : Mouse lung cell extract
    Lane 8 : Rat brain cell extract
    Lane 9 : Rat testis cell extract

    Developed using the ECL technique.

    Predicted band size: 19 kDa

  • Formalin-fixed, paraffin-embedded human brain cortex tissue stained for Calcineurin B/CNB with ab230899 at 1/50 dilution in immunohistochemical analysis.

References

ab230899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up