Overview

  • Product name

    Anti-Calcineurin B/CNB antibody
    See all Calcineurin B/CNB primary antibodies
  • Description

    Rabbit polyclonal to Calcineurin B/CNB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Calcineurin B/CNB aa 2-170. (Expressed in E.coli).
    Sequence:

    GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQ NPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDM DKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFE EFCAVVGGLDIHKKMVVDV


    Database link: P63098

  • Positive control

    • IHC-P: Human cerebrum tissue. WB: Pig stomach lysate; HeLa and A431 cell lysates; Recombinant human Calcineurin B/CNB protein.
  • General notes

     This product was previously labelled as Calcineurin B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Function

    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similarities

    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha isoform (calcineurin B, type I) antibody
    • calcineurin B, type I (19kDa) antibody
    • Calcineurin subunit B type 1 antibody
    • CALNB1 antibody
    • CANB1_HUMAN antibody
    • Cna2 antibody
    • CNB antibody
    • CNB1 antibody
    • OTTHUMP00000201960 antibody
    • OTTHUMP00000201961 antibody
    • Ppp3r1 antibody
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform antibody
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform antibody
    • Protein phosphatase 2B regulatory subunit 1 antibody
    • Protein phosphatase 2B regulatory subunit B alpha antibody
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 regulatory subunit B alpha antibody
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1 antibody
    see all

Images

  • Paraffin-embedded human cerebrum tissue stained for Calcineurin B/CNB using ab231630 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for Calcineurin B/CNB using ab231630 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Calcineurin B/CNB antibody (ab231630) at 3 µg/ml + Recombinant human Calcineurin B/CNB protein

    Predicted band size: 19 kDa

  • All lanes : Anti-Calcineurin B/CNB antibody (ab231630) at 3 µg/ml

    Lane 1 : Pig stomach lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 19 kDa

References

ab231630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up