Overview

  • Product name

    Anti-Calcineurin B/CNB antibody
    See all Calcineurin B/CNB primary antibodies
  • Description

    Rabbit polyclonal to Calcineurin B/CNB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Calcineurin B/CNB aa 2-51 (N terminal).
    Sequence:

    GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQ


    Database link: NP_000936

  • Positive control

    • NCI-H226 cell lysate
  • General notes

     This product was previously labelled as Calcineurin B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab94535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similarities

    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha isoform (calcineurin B, type I) antibody
    • calcineurin B, type I (19kDa) antibody
    • Calcineurin subunit B type 1 antibody
    • CALNB1 antibody
    • CANB1_HUMAN antibody
    • Cna2 antibody
    • CNB antibody
    • CNB1 antibody
    • OTTHUMP00000201960 antibody
    • OTTHUMP00000201961 antibody
    • Ppp3r1 antibody
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform antibody
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform antibody
    • Protein phosphatase 2B regulatory subunit 1 antibody
    • Protein phosphatase 2B regulatory subunit B alpha antibody
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) antibody
    • Protein phosphatase 3 regulatory subunit B alpha antibody
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1 antibody
    see all

Images

  • Anti-Calcineurin B/CNB antibody (ab94535) at 1 µg/ml (in 5% skim milk / PBS buffer) + NCI-H226 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 19 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Hsieh HY & Gu SH Expression of calcineurin in relation to the embryonic diapause process in the silkworm, Bombyx mori. Comp Biochem Physiol A Mol Integr Physiol 228:35-42 (2019). Read more (PubMed: 30367963) »
  • Moore TM  et al. The impact of exercise on mitochondrial dynamics and the role of Drp1 in exercise performance and training adaptations in skeletal muscle. Mol Metab N/A:N/A (2018). Read more (PubMed: 30591411) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up