Overview

  • Product name

    Anti-Calcipressin 1/RCAN1 antibody
    See all Calcipressin 1/RCAN1 primary antibodies
  • Description

    Rabbit polyclonal to Calcipressin 1/RCAN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to Human Calcipressin 1/RCAN1 aa 180-229 (internal sequence).
    Sequence:

    PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME


    Database link: NP_004405

  • Positive control

    • Fetal muscle lysate
  • General notes

     This product was previously labelled as Calcipressin 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab83271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 28 kDa (predicted molecular weight: 23 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development.
  • Tissue specificity

    Highly expressed heart, brain and skeletal muscle. Also expressed in all other tissues.
  • Sequence similarities

    Belongs to the RCAN family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapt 78 antibody
    • Adapt78 antibody
    • Calcipressin 1 antibody
    • Calcipressin-1 antibody
    • Calcium and oxidant inducible mRNA antibody
    • CSP 1 antibody
    • CSP1 antibody
    • Down syndrome candidate region 1 antibody
    • Down syndrome critical region gene 1 antibody
    • Down syndrome critical region protein 1 antibody
    • DSC 1 antibody
    • DSC1 antibody
    • DSCR 1 antibody
    • DSCR1 antibody
    • MCIP 1 antibody
    • MCIP1 antibody
    • Modulatory calcineurin interacting protein 1 antibody
    • Myocyte enriched calcineurin interacting protein 1 antibody
    • Myocyte-enriched calcineurin-interacting protein 1 antibody
    • Near DSCR proline rich protein antibody
    • RCAN1 antibody
    • RCAN1_HUMAN antibody
    • RCN 1 antibody
    • RCN1 antibody
    • Regulator of calcineurin 1 antibody
    see all

Images

  • Anti-Calcipressin 1/RCAN1 antibody (ab83271) at 1 µg/ml + Fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 23 kDa
    Observed band size: 28 kDa
    why is the actual band size different from the predicted?

  • All lanes : Anti-Calcipressin 1/RCAN1 antibody (ab83271) at 1/1000 dilution

    Lane 1 : Whole cell lysate prepared from primary mouse bone marrow derived osteoclasts with a point mutation in VATPase
    Lane 2 : Whole cell lysate prepared from wild type mouse osteoclasts

    Secondary
    All lanes : HRP conjugated anti-rabbit at 1/2000 dilution

    Predicted band size: 23 kDa

References

ab83271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (induced pluripotent stem cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
50 µg
Specification
induced pluripotent stem cells
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 22°C

Dr. Kate Hawkins

Verified customer

Submitted Nov 13 2018

Application
Western blot
Sample
Human Cell lysate - whole cell (Fibroblasts)
Gel Running Conditions
Reduced Denaturing
Loading amount
50 µg
Specification
Fibroblasts
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Nov 06 2018

Application
Western blot
Sample
Rat Cell lysate - whole cell (cultured cortical neuron)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
10 µg
Specification
cultured cortical neuron
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Feb 25 2013

Application
Western blot
Sample
Mouse Cell lysate - other (cortical neurons)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
10 µg
Specification
cortical neurons
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Feb 08 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up