Calciseptine (Recombinant), L-type Ca2+ channel blocker (ab141856)

Overview

  • Product name

    Calciseptine (Recombinant), L-type Ca2+ channel blocker
  • Description

    Potent, specific L-type Ca2+ channel blocker
  • Biological description

    Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiacontraction inhibitor. Neurotoxic. Active in vivo and in vitro.
  • Purity

    > 98%
  • CAS Number

    178805-91-9
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    7167.40
  • Molecular formula

    C304H477N91O88S11
  • Sequence

    MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Dendroaspis polylepis polylepis

  • Research areas

References

This product has been referenced in:

  • García MC  et al. Calciseptine, a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle. J Membr Biol 184:121-9 (2001). Read more (PubMed: 11719849) »
  • Watanabe TX  et al. Smooth muscle relaxing and hypotensive activities of synthetic calciseptine and the homologous snake venom peptide FS2. Jpn J Pharmacol 68:305-13 (1995). Read more (PubMed: 7474554) »
  • de Weille JR  et al. Calciseptine, a peptide isolated from black mamba venom, is a specific blocker of the L-type calcium channel. Proc Natl Acad Sci U S A 88:2437-40 (1991). Read more (PubMed: 1848702) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up