Overview

  • Product name

  • Description

    Rabbit polyclonal to Calcitonin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Dog
  • Immunogen

    Recombinant full length protein corresponding to Dog Calcitonin aa 86-116.
    Sequence:

    CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP


    Database link: P41547

  • Positive control

    • WB: Dog Calcitonin recombinant protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab222883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 20 kDa (predicted molecular weight: 14 kDa).

Target

  • Relevance

    Calcitonin is a 32 amino acid peptide hormone synthesized by the parafollicular cells of the thyroid. It causes a rapid, but short lived, reduction in serum calcium and phosphate by promoting the incorporation of those ions in the bones. This effect is opposite to that of parathyroid hormone. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
  • Cellular localization

    Cytoplasmic and Secreted
  • Database links

  • Alternative names

    • Alpha CGRP antibody
    • alpha type CGRP antibody
    • CALC 1 antibody
    • CALC A antibody
    • CALC1 antibody
    • calcitonin 1 antibody
    • calcitonin gene related peptide 1 antibody
    • calcitonin gene related peptide I antibody
    • calcitonin related polypeptide alpha antibody
    • CGRP 1 antibody
    • CGRP antibody
    • CGRP I antibody
    • CGRP1 antibody
    • CT antibody
    • katacalcin antibody
    • KC antibody
    see all

Images

  • All lanes : Anti-Calcitonin antibody (ab222883) at 1/500 dilution

    Lane 1 : Dog Calcitonin Recombinant protein at 0.08 µg
    Lane 2 : Dog Calcitonin Recombinant protein at 0.04 µg
    Lane 3 : Dog Calcitonin Recombinant protein at 0.025 µg
    Lane 4 : Dog Calcitonin Recombinant protein at 0.0125 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 14 kDa
    Observed band size: 20 kDa
    why is the actual band size different from the predicted?

References

ab222883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up