
  • Product name
    Calcitonin (human), bone resorption inhibitor
  • Description
    Bone resorption inhibitor
  • Biological description
    Bone resorption inhibitor. Calcium regulating hormone and bone density conservation agent. Active in vivo and in vitro. Orally active
  • Purity
    > 95%
  • CAS Number
  • Chemical structure
    Chemical Structure


  • Molecular weight
  • Molecular formula
  • Sequence
    CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP (Modifications: C-terminal amide; Disulfide bonds: 1-7)
  • PubChem identifier
  • Storage instructions
    Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview
    Soluble in 5% acetic acid
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source


  • Research areas


This product has been referenced in:
  • Arvinte T & Drake AF Comparative study of human and salmon calcitonin secondary structure in solutions with low dielectric constants. J Biol Chem 268:6408-14 (1993). Read more (PubMed: 8454613) »
  • Grauer A  et al. A new in vitro bioassay for human calcitonin: validation and comparison to the rat hypocalcemia bioassay. Bone Miner 17:65-74 (1992). Read more (PubMed: 1316197) »
  • Hastewell J  et al. Absorption of human calcitonin across the rat colon in vivo. Clin Sci (Lond) 82:589-94 (1992). Read more (PubMed: 1317770) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142264.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up