Overview

  • Product name
    Calcitonin (salmon), CGRP receptor binding affinity
  • Description
    Potent CGRP receptor binding affinity
  • Biological description
    Potent calcitonin gene-related peptide receptor binding affinity (IC50 = 250 nM). Inhibits bone resorption and lowers serum calcium. Polypeptide hormone. Bone density conservation agent. Active in vivo and in vitro.
  • Purity
    > 98%

Properties

  • Molecular weight
    3431.85
  • Chemical structure
    Chemical Structure
  • Molecular formula
    C145H240N44O48S2
  • CAS Number
    47931-85-1
  • Sequence
    CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Modifications: C-terminal amide; Disulfide bonds: 1-7)
  • PubChem identifier
    16129616
  • Storage instructions
    Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview
    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Toxic, refer to SDS for further information.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • SMILES
    CC(C)CC1C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CC(=O)N)CO)N)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC2=CN=CN2)C(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CCC(=O)N)C(=O)NC(C(C)O)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)N4CCCC4C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C(C)O)C(=O)NCC(=O)NC(CO)C(=O)NCC(=O)NC(C(C)O)C(=O)N5CCCC5C(=O)N)C(C)O)CO
  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:
  • van Rossum D  et al. Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors. Neurosci Biobehav Rev 21:649-78 (1997). Read more (PubMed: 9353797) »
  • Wimalawansa SJ & el-Kholy AA Comparative study of distribution and biochemical characterization of brain calcitonin gene-related peptide receptors in five different species. Neuroscience 54:513-9 (1993). Read more (PubMed: 8393155) »
  • Habener JF  et al. Explanation for unusual potency of salmon calcitonin. Nat New Biol 232:91-2 (1971). Read more (PubMed: 5285350) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE, NOT FOR USE IN HUMANS"

Sign up