For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    calcium-independent-phospholipase-a2pla2g6-antibody-ab244247.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway Lipid Signaling PLA
Share by email

Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
  • Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
  • Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)

Key features and details

  • Rabbit polyclonal to Calcium-independent Phospholipase A2/PLA2G6
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody
    See all Calcium-independent Phospholipase A2/PLA2G6 primary antibodies
  • Description

    Rabbit polyclonal to Calcium-independent Phospholipase A2/PLA2G6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Calcium-independent Phospholipase A2/PLA2G6 aa 100-250.
    Sequence:

    QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAEN EEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNS QVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIM G


    Database link: O60733
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEL cell lysate. Calcium-independent Phospholipase A2/PLA2G6 overexpression HEK-293T cell lysate. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as Calcium-independent Phospholipase A2

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Lipid Signaling
    • PLA

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

Applications

Our Abpromise guarantee covers the use of ab244247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 90 kDa.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
    Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.
  • Tissue specificity

    Four different transcripts were found to be expressed in a distinct tissue distribution.
  • Involvement in disease

    Neurodegeneration with brain iron accumulation 2B
    Neurodegeneration with brain iron accumulation 2A
    Parkinson disease 14
  • Sequence similarities

    Contains 7 ANK repeats.
    Contains 1 patatin domain.
  • Cellular localization

    Cytoplasm and Membrane. Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.
  • Target information above from: UniProt accession O60733 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 8398 Human
    • Entrez Gene: 53357 Mouse
    • Entrez Gene: 360426 Rat
    • Omim: 603604 Human
    • SwissProt: O60733 Human
    • SwissProt: P97819 Mouse
    • SwissProt: P97570 Rat
    • Unigene: 170479 Human
    • Unigene: 155620 Mouse
    • Unigene: 44692 Rat
    see all
  • Form

    The isoform LH-iPLA2 is located at the membrane. The isoform SH-iPLA2 is cytoplasmic.
  • Alternative names

    • 85 kDa calcium independent phospholipase A2 antibody
    • 85/88 kDa calcium-independent phospholipase A2 antibody
    • BB112799 antibody
    • CaI PLA2 antibody
    • CaI-PLA2 antibody
    • CaIPLA2 antibody
    • Calcium independent phospholipase A2 antibody
    • CTA-228A.2 antibody
    • Cytosolic calcium independent phospholipase A2 antibody
    • EC 3.1.1.4 antibody
    • Group VI phospholipase A2 antibody
    • Group VI, A antibody
    • GVI antibody
    • GVI PLA2 antibody
    • INAD1 antibody
    • Intracellular membrane associated calcium independent phospholipase A2 beta antibody
    • Intracellular membrane-associated calcium-independent phospholipase A2 beta antibody
    • iPLA(2)beta antibody
    • iPLA2 beta antibody
    • iPLA2-beta antibody
    • IPLA2-VIA antibody
    • iPLA2beta antibody
    • NBIA2 antibody
    • NBIA2A antibody
    • NBIA2B antibody
    • Neurodegeneration with brain iron accumulation 2 antibody
    • OTTHUMP00000199457 antibody
    • PARK14 antibody
    • Patatin like phospholipase domain containing 9 antibody
    • Patatin like phospholipase domain containing protein 9 antibody
    • Patatin-like phospholipase domain-containing protein 9 antibody
    • Phospholipase A2 calcium independent antibody
    • Phospholipase A2 calcium independent group VI A antibody
    • Phospholipase A2 group VI antibody
    • Phospholipase A2 group VI cytosolic calcium independent antibody
    • Phospholipase A2, group VI (cytosolic, calcium independent) antibody
    • PLA2 antibody
    • PLA2G6 antibody
    • PLPL9_HUMAN antibody
    • PNPLA9 antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
    Immunocytochemistry/ Immunofluorescence - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)

    PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling Calcium-independent Phospholipase A2/PLA2G6 using ab244247 at 4 µg/ml (green) in ICC/IF.

  • Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
    Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
    Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml + HEL (Human bone marrow erythroleukemia cell line) cell lysate

    Predicted band size: 90 kDa

  • Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
    Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
    All lanes : Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Calcium-independent Phospholipase A2 overexpression HEK-293T cell lysate

    Predicted band size: 90 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab244247? Please let us know so that we can cite the reference in this datasheet.

    ab244247 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab244247.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.