Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody
See all Calcium-independent Phospholipase A2/PLA2G6 primary antibodies -
Description
Rabbit polyclonal to Calcium-independent Phospholipase A2/PLA2G6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human Calcium-independent Phospholipase A2/PLA2G6 aa 100-250.
Sequence:QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAEN EEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNS QVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIM G
Database link: O60733 -
Positive control
- WB: HEL cell lysate. Calcium-independent Phospholipase A2/PLA2G6 overexpression HEK-293T cell lysate. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as Calcium-independent Phospholipase A2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244247 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 90 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity. -
Tissue specificity
Four different transcripts were found to be expressed in a distinct tissue distribution. -
Involvement in disease
Neurodegeneration with brain iron accumulation 2B
Neurodegeneration with brain iron accumulation 2A
Parkinson disease 14 -
Sequence similarities
Contains 7 ANK repeats.
Contains 1 patatin domain. -
Cellular localization
Cytoplasm and Membrane. Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes. - Information by UniProt
-
Database links
- Entrez Gene: 8398 Human
- Entrez Gene: 53357 Mouse
- Entrez Gene: 360426 Rat
- Omim: 603604 Human
- SwissProt: O60733 Human
- SwissProt: P97819 Mouse
- SwissProt: P97570 Rat
- Unigene: 170479 Human
see all -
Form
The isoform LH-iPLA2 is located at the membrane. The isoform SH-iPLA2 is cytoplasmic. -
Alternative names
- 85 kDa calcium independent phospholipase A2 antibody
- 85/88 kDa calcium-independent phospholipase A2 antibody
- BB112799 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling Calcium-independent Phospholipase A2/PLA2G6 using ab244247 at 4 µg/ml (green) in ICC/IF.
-
Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml + HEL (Human bone marrow erythroleukemia cell line) cell lysate
Predicted band size: 90 kDa -
Western blot - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)All lanes : Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml
Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : Calcium-independent Phospholipase A2 overexpression HEK-293T cell lysate
Predicted band size: 90 kDa
Datasheets and documents
References
ab244247 has not yet been referenced specifically in any publications.
