Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
Key features and details
- Rabbit polyclonal to Calcium-independent Phospholipase A2/PLA2G6
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody
See all Calcium-independent Phospholipase A2/PLA2G6 primary antibodies -
Description
Rabbit polyclonal to Calcium-independent Phospholipase A2/PLA2G6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human Calcium-independent Phospholipase A2/PLA2G6 aa 100-250.
Sequence:QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAEN EEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNS QVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIM G
Database link: O60733 -
Positive control
- WB: HEL cell lysate. Calcium-independent Phospholipase A2/PLA2G6 overexpression HEK-293T cell lysate. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as Calcium-independent Phospholipase A2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244247 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 90 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity. -
Tissue specificity
Four different transcripts were found to be expressed in a distinct tissue distribution. -
Involvement in disease
Neurodegeneration with brain iron accumulation 2B
Neurodegeneration with brain iron accumulation 2A
Parkinson disease 14 -
Sequence similarities
Contains 7 ANK repeats.
Contains 1 patatin domain. -
Cellular localization
Cytoplasm and Membrane. Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes. - Information by UniProt
-
Database links
- Entrez Gene: 8398 Human
- Entrez Gene: 53357 Mouse
- Entrez Gene: 360426 Rat
- Omim: 603604 Human
- SwissProt: O60733 Human
- SwissProt: P97819 Mouse
- SwissProt: P97570 Rat
- Unigene: 170479 Human
see all -
Form
The isoform LH-iPLA2 is located at the membrane. The isoform SH-iPLA2 is cytoplasmic. -
Alternative names
- 85 kDa calcium independent phospholipase A2 antibody
- 85/88 kDa calcium-independent phospholipase A2 antibody
- BB112799 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247)
PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling Calcium-independent Phospholipase A2/PLA2G6 using ab244247 at 4 µg/ml (green) in ICC/IF.
-
Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml + HEL (Human bone marrow erythroleukemia cell line) cell lysate
Predicted band size: 90 kDa -
All lanes : Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab244247) at 0.4 µg/ml
Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : Calcium-independent Phospholipase A2 overexpression HEK-293T cell lysate
Predicted band size: 90 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244247 has not yet been referenced specifically in any publications.