Overview

  • Product name

    Anti-Calcium Pump PMCA3 ATPase antibody
    See all Calcium Pump PMCA3 ATPase primary antibodies
  • Description

    Rabbit polyclonal to Calcium Pump PMCA3 ATPase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Calcium Pump PMCA3 ATPase aa 1115-1219.
    Sequence:

    IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDV DENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLH SVETS


    Database link: Q16720

  • Positive control

    • IHC-P: Human cerebellum tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Calcium Pump PMCA3 ATPase belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. Calcium Pump PMCA3 ATPase is the plasma membrane calcium ATPase isoform 3.
  • Cellular localization

    Cell membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • ATP2B3 antibody
    • ATP2B3 protein antibody
    • ATPase Ca++ transporting plasma membrane 3 antibody
    • ATPase plasma membrane Ca2+ transporting 3 antibody
    • Plasma membrane calcium ATPase 3 antibody
    • Plasma membrane calcium ATPase isoform 3 antibody
    • Plasma membrane calcium pump isoform 3 antibody
    • Plasma membrane calcium transporting ATPase 3 antibody
    • PMCA 3 antibody
    • PMCA3 antibody
    • PMCA3a antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Calcium Pump PMCA3 ATPase (green) using ab223787 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human cerebellum tissue stained for Calcium Pump PMCA3 ATPase using ab223787 at 1/200 dilution in immunohistochemical analysis.

References

ab223787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up