Overview

  • Product name

    Anti-calcyphosine antibody
    See all calcyphosine primary antibodies
  • Description

    Rabbit polyclonal to calcyphosine
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Recombinant full length protein corresponding to Human calcyphosine aa 1-189. (Expressed in E.coli)
    Sequence:

    MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGL AKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAA AFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDS SEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL


    Database link: Q13938

  • Positive control

    • WB: Recombinant human calcyphosine protein; Pig spleen Tissue; HEK-293T cell lysate. IHC-P: Human prostate, kidney and breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 21 kDa.

Target

Images

  • All lanes : Anti-calcyphosine antibody (ab231355) at 3 µg/ml

    Lane 1 : Pig spleen tissue lysate.
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 21 kDa

  • Anti-calcyphosine antibody (ab231355) at 3 µg/ml + Recombinant human Calcyphosine protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 21 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Calcyphosine using ab231355 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Calcyphosine using ab231355 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Calcyphosine using ab231355 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up