Overview

  • Product name

  • Description

    Rabbit polyclonal to CalDAG-GEFI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human CalDAG-GEFI aa 25-139.
    Sequence:

    DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVK TCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSV PTYKWKRQVTQRNPV


    Database link: Q7LDG7

  • Positive control

    • IHC: Human skeletal muscle tissue. WB: Human tonsil tissue lysate.
  • General notes

    Protein previously labeled as RASGRP2.

Properties

Applications

Our Abpromise guarantee covers the use of ab224377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 69 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.
  • Tissue specificity

    Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the RASGRP family.
    Contains 2 EF-hand domains.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-GEF domain.
  • Developmental stage

    Expressed in fetal brain, lung, liver and kidney.
  • Domain

    The N-terminal Ras-GEF domain mediates association with F-actin.
  • Post-translational
    modifications

    Isoform 2 is palmitoylated and myristoylated while isoform 1.
  • Cellular localization

    Cytoplasm > cytosol. Cell membrane. Cell junction > synapse > synaptosome. Cell projection > ruffle membrane. Found both in the cytosol and associated with membranes. Isoform 2 mainly localizes to the cell membrane. Enriched at juxtamembrane areas and membrane ruffles through association with F-actin. Localizes to the cell bodies and axons of striatal neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium and DAG-regulated antibody
    • Calcium and DAG-regulated guanine nucleotide exchange factor I antibody
    • Calcium-and diacylglycerol-regulated guanine nucleotide exchange factor I antibody
    • CalDAG-GEFI antibody
    • Cdc25 like protein antibody
    • Cdc25-like protein antibody
    • F25B3.3 kinase like protein antibody
    • F25B3.3 kinase-like protein antibody
    • GRP2_HUMAN antibody
    • HCDC25L antibody
    • RAS guanyl releasing protein 2 antibody
    • RAS guanyl-releasing protein 2 antibody
    • Rasgrp2 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for CalDAG-GEFI using ab224377 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-CalDAG-GEFI antibody (ab224377) at 1/250 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 69 kDa

References

ab224377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up