Overview

  • Product name

    Anti-Caldesmon/CDM antibody
    See all Caldesmon/CDM primary antibodies
  • Description

    Rabbit polyclonal to Caldesmon/CDM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Chinese hamster, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide within Human Caldesmon/CDM aa 500-550. The exact sequence is proprietary.
    Sequence:

    THKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESE E


    Database link: Q05682

  • Positive control

    • HeLa and 293T whole cell lysates.
  • General notes

     This product was previously labelled as Caldesmon

     

Properties

Applications

Our Abpromise guarantee covers the use of ab183146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 93 kDa.

Target

  • Function

    Actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and nonmuscle cells (could act as a bridge between myosin and actin filaments). Stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, inhibits the actomyosin ATPase by binding to F-actin. This inhibition is attenuated by calcium-calmodulin and is potentiated by tropomyosin. Interacts with actin, myosin, two molecules of tropomyosin and with calmodulin. Also play an essential role during cellular mitosis and receptor capping.
  • Tissue specificity

    High-molecular-weight caldesmon (isoform 1) is predominantly expressed in smooth muscles, whereas low-molecular-weight caldesmon (isoforms 2, 3, 4 and 5) are widely distributed in non-muscle tissues and cells. Not expressed in skeletal muscle or heart.
  • Sequence similarities

    Belongs to the caldesmon family.
  • Domain

    The N-terminal part seems to be a myosin/calmodulin-binding domain, and the C-terminal a tropomyosin/actin/calmodulin-binding domain. These two domains are separated by a central helical region in the smooth-muscle form.
  • Post-translational
    modifications

    In non-muscle cells, phosphorylation by CDK1 during mitosis causes caldesmon to dissociate from microfilaments. Phosphorylation reduces caldesmon binding to actin, myosin, and calmodulin as well as its inhibition of actomyosin ATPase activity. Phosphorylation also occurs in both quiescent and dividing smooth muscle cells with similar effects on the interaction with actin and calmodulin and on microfilaments reorganization.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > myofibril. On thin filaments in smooth muscle and on stress fibers in fibroblasts (nonmuscle).
  • Information by UniProt
  • Database links

  • Alternative names

    • CAD antibody
    • CALD 1 antibody
    • CALD1 antibody
    • CALD1_HUMAN antibody
    • Caldesmon 1 antibody
    • Caldesmon 1 Isoform 1 antibody
    • Caldesmon 1 Isoform 2 antibody
    • Caldesmon 1 Isoform 3 antibody
    • Caldesmon 1 Isoform 4 antibody
    • Caldesmon 1 Isoform 5 antibody
    • Caldesmon antibody
    • Caldesmon1 antibody
    • CDM antibody
    • H CAD antibody
    • HCAD antibody
    • L CAD antibody
    • LCAD antibody
    • MGC21352 antibody
    • NAG22 antibody
    see all

Images

  • Immunoprecipitation of HeLa whole cell lysate using ab183146 at 6 µg/mg of lysate (1 mg/IP; 20% of IP loaded per lane) followed by detection of Caldesmon/CDM with ab183146 at 1 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody.

    Exposure: 10second

    developed using the ECL technique

  • All lanes : Anti-Caldesmon/CDM antibody (ab183146) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 93 kDa


    Exposure time: 3 minutes

References

ab183146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up