Overview

  • Product name

  • Description

    Rabbit polyclonal to CALML3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CALML3 aa 1-149. (Expressed in E.coli).
    Sequence:

    MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELR DMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGF VSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK


    Database link: P27482

  • Positive control

    • WB: A431 cell lysate; Rat skin lysate; Recombinant human CALML3 protein. IHC-P: Human cerebrum, liver, esophagus, stomach, prostate cancer and uterine fibroids tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 17 kDa.

Target

  • Function

    May be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.
  • Tissue specificity

    Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
  • Sequence similarities

    Belongs to the calmodulin family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CALL3_HUMAN antibody
    • CALML3 antibody
    • Calmodulin like 3 antibody
    • Calmodulin related protein NB 1 antibody
    • Calmodulin-like protein 3 antibody
    • Calmodulin-related protein NB-1 antibody
    • CaM like protein antibody
    • CaM-like protein antibody
    • CLP antibody
    • OTTHUMP00000019004 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human uterine fibroids tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human esophagus tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for CALML3 using ab233037 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • All lanes : Anti-CALML3 antibody (ab233037) at 1 µg/ml

    Lane 1 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 2 : Rat skin lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 17 kDa

  • Anti-CALML3 antibody (ab233037) at 2 µg/ml + Recombinant human CALML3 protein

    Predicted band size: 17 kDa

References

ab233037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up