Overview

  • Product name

  • Description

    Rabbit polyclonal to Calpain 14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Calpain 14 aa 301-350 (internal sequence). The exact sequence is proprietary.
    Sequence:

    ILEAHQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKF


    Database link: A8MX76-2

  • Positive control

    • MCF7 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab192994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

  • Function

    Calcium-regulated non-lysosomal thiol-protease.
  • Tissue specificity

    Not expressed in tissues tested.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium-activated neutral proteinase 14 antibody
    • Calpain-14 antibody
    • CAN14_HUMAN antibody
    • CANP 14 antibody
    • CAPN14 antibody
    see all

Images

  • Anti-Calpain 14 antibody (ab192994) at 1 µg/ml + MCF7 whole cell lysate at 10 µg

    Predicted band size: 59 kDa

References

ab192994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up