Overview

  • Product name

  • Description

    Rabbit polyclonal to Calpain 14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Calpain 14 aa 43-684.
    Sequence:

    LFEDTSFPATLSSIGSGSLLQKLPPRLQWKRPPELHSNPQFYFAKAKRLD LCQGIVGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFWHY GNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDL QSGQVSEALVDFTGGVTMTINLAEAHGNLWDILIEATYNRTLIGCQTHSG EKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPWGKVEWKGDWSDS SSKWELLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQ EAAQKWTYTMREGRWEKRSTAGGQRQLLQDTFWKNPQFLLSVWRPEEGRR SLRPCSVLVSLLQKPRHRCRKRKPLLAIGFYLYRMNKYHDDQRRLPPEFF QRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEAHQKSEFVLRVFS RKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQNLL NQMTWSSLGSRQPFFSLEACQGILALLDLNASGTMSIQEFRDLWKQLKLS QKVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGGPRLQMD FVSFIHLMLRVENMEDVFQNLTQDGKGIYLQKPEWMMMALYS


    Database link: A8MX76-1

  • Positive control

    • IHC-P: Human ovarian cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Calcium-regulated non-lysosomal thiol-protease.
  • Tissue specificity

    Not expressed in tissues tested.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium-activated neutral proteinase 14 antibody
    • Calpain-14 antibody
    • CAN14_HUMAN antibody
    • CANP 14 antibody
    • CAPN14 antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for Calpain 14 using ab234692 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for Calpain 14 (green) using ab234692 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up