Overview

  • Product name

  • Description

    Rabbit polyclonal to Calpain 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Calpain 3 aa 581-677.
    Sequence:

    SEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSP DKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVL


    Database link: P20807

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Calcium-regulated non-lysosomal thiol-protease.
  • Tissue specificity

    Isoform I is skeletal muscle specific.
  • Involvement in disease

    Defects in CAPN3 are the cause of limb-girdle muscular dystrophy type 2A (LGMD2A) [MIM:253600]. LGMD2A is an autosomal recessive degenerative myopathy characterized by progressive symmetrical atrophy and weakness of the proximal limb muscles and elevated serum creatine kinase. The symptoms usually begin during the first two decades of life, and the disease gradually worsens, often resulting in loss of walking ability 10 or 20 years after onset.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 4 EF-hand domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium-activated neutral proteinase 3 antibody
    • calpain 3, (p94) antibody
    • Calpain L3 antibody
    • Calpain large polypeptide L3 antibody
    • Calpain p94 antibody
    • calpain p94, large [catalytic] subunit antibody
    • calpain, large polypeptide L3 antibody
    • Calpain-3 antibody
    • CAN3_HUMAN antibody
    • CANP 3 antibody
    • CANP3 antibody
    • CANPL3 antibody
    • CAPN3 antibody
    • LGMD 2A antibody
    • LGMD2 antibody
    • LGMD2A antibody
    • Lp82 antibody
    • Lp85 antibody
    • MGC10767 antibody
    • MGC11121 antibody
    • MGC14344 antibody
    • MGC4403 antibody
    • Muscle-specific calcium-activated neutral protease 3 antibody
    • muscle-specific calcium-activated neutral protease 3 large subunit antibody
    • nCL-1 antibody
    • New calpain 1 antibody
    • p94 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for Calpain 3 using ab223766 at 1/500 dilution in immunohistochemical analysis.

References

ab223766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up