Overview

  • Product name

    Anti-Calpain 5 antibody [OTI7D2]
    See all Calpain 5 primary antibodies
  • Description

    Mouse monoclonal [OTI7D2] to Calpain 5
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Calpain 5 aa 274-578. (NP_004046) produced in E.coli.
    Sequence:

    SEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEF WMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNR GGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLA IGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPT TFEPGHTGEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHV LGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKL SQPIT


    Database link: O15484

  • Positive control

    • IHC-P: Human prostate carcinoma and colon tissue.
  • General notes

    Clone OTI7D2 (formerly 7D2).

Properties

Applications

Our Abpromise guarantee covers the use of ab236377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

Images

  • Paraffin-embedded human colon tissue stained for Calpain 5 with ab236377 at a 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for Calpain 5 with ab236377 at a 1/150 dilution in immunohistochemical analysis.

References

ab236377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up