Anti-Calpain 9 antibody (ab187862)
Key features and details
- Rabbit polyclonal to Calpain 9
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Calpain 9 antibody
See all Calpain 9 primary antibodies -
Description
Rabbit polyclonal to Calpain 9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Calpain 9 aa 463-562.
Sequence:PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTP PDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS
Database link: O14815 -
Positive control
- Human stomach tissue
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab187862 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Calcium-regulated non-lysosomal thiol-protease. -
Tissue specificity
Expressed predominantly in stomach. -
Sequence similarities
Belongs to the peptidase C2 family.
Contains 1 calpain catalytic domain.
Contains 3 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 10753 Human
- Omim: 606401 Human
- SwissProt: O14815 Human
- Unigene: 498021 Human
-
Alternative names
- Calpain-9 antibody
- Calpain9 antibody
- CAN9_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Calpain 9 antibody (ab187862)Immunohistochemical staining of formalin-fixed paraffin embedded Human stomach tissue labeling Calpain 9 using ab187862 at 1/500 dilution.
Datasheets and documents
References (0)
ab187862 has not yet been referenced specifically in any publications.
