Overview

  • Product name

  • Description

    Rabbit polyclonal to Calpain 9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Calpain 9 aa 463-562.
    Sequence:

    PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTP PDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS


    Database link: O14815

  • Positive control

    • Human stomach tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab187862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Calcium-regulated non-lysosomal thiol-protease.
  • Tissue specificity

    Expressed predominantly in stomach.
  • Sequence similarities

    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calpain-9 antibody
    • Calpain9 antibody
    • CAN9_HUMAN antibody
    • CAPN 9 antibody
    • CAPN9 antibody
    • CG36 protein antibody
    • Digestive tract specific calpain antibody
    • Digestive tract-specific calpain antibody
    • GC36 antibody
    • nCL-4 antibody
    • nCL4 antibody
    • New calpain 4 antibody
    • novel calpain large subunit-4 antibody
    • novel calpain large subunit4 antibody
    • OTTHUMP00000035899 antibody
    • OTTHUMP00000035900 antibody
    • Protein CG36 antibody
    see all

Images

  • Immunohistochemical staining of formalin-fixed paraffin embedded Human stomach tissue labeling Calpain 9 using ab187862 at 1/500 dilution.

References

ab187862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up