Overview

  • Product name

  • Description

    Rabbit polyclonal to Calpastatin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Calpastatin aa 188-273.
    Sequence:

    STYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSS DFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAP


    Database link: P20810

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
  • Sequence similarities

    Belongs to the protease inhibitor I27 (calpastatin) family.
  • Domain

    Has four inhibitory domains.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Information by UniProt
  • Database links

  • Alternative names

    • BS 17 antibody
    • Calpain inhibitor antibody
    • Calpastatin antibody
    • Cast antibody
    • Heart type calpastatin antibody
    • ICAL_HUMAN antibody
    • MGC9402 antibody
    • Sperm BS 17 component antibody
    • Sperm BS-17 component antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for Calpastatin using ab244459 at 1/50 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for Calpastatin (green) using ab244459 at 4 µg/ml in ICC/IF.

References

ab244459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up