Overview

  • Product name

    Anti-Calponin 1 antibody - C-terminal
    See all Calponin 1 primary antibodies
  • Description

    Rabbit polyclonal to Calponin 1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, IHC-Fr, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Calponin 1 aa 240-290 (C terminal) conjugated to keyhole limpet haemocyanin.
    Sequence:

    TLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHH A


    Database link: P51911

  • Positive control

    • Rat brain, Human gastric carcinoma and mouse stomach tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/500 - 1/1000.
IHC-Fr 1/100 - 1/500.

(1/50 - 1/200 if using a fluorescent secondary antibody)

WB 1/100 - 1/1000. Predicted molecular weight: 33 kDa.
IHC-P 1/100 - 1/500.

(1/50 - 1/200 if using a fluorescent secondary antibody)

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse stomach tissue labeling Calponin 1 with ab203047 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human gastric carcinoma tissue labeling Calponin 1 with ab203047 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue labeling Calponin 1 with ab203047 at 1/100 dilution.

References

ab203047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up