Overview

  • Product name

    Anti-Calponin 1 antibody [CNN1/832 + CALP]
    See all Calponin 1 primary antibodies
  • Description

    Mouse monoclonal [CNN1/832 + CALP] to Calponin 1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    This product was produced with the following immunogens:
    Recombinant full length protein corresponding to Human Calponin 1 aa 1-297. (CNN1/832).
    Sequence:

    MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF MDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGV KPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQER KFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLD QATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSN KGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA


    Database link: P51911

    Tissue, cells or virus. (Crude human uterus extract (CALP)).

  • Positive control

    • IHC-P: Human uterus and breast carcinoma tissues; Rat uterus tissues.
  • General notes

    Please note that this antibody is an oligoclonal antibody. It is a cocktail of monoclonal antibodies that have been carefully selected. Oligoclonal antibodies have not only the specificity and batch-to-batch consistency of a monoclonal antibody, but also have the advantage of the sensitivity of a polyclonal antibody due to their ability to recognize multiple epitopes on an antigen. 

Properties

Applications

Our Abpromise guarantee covers the use of ab233854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificity

    Smooth muscle, and tissues containing significant amounts of smooth muscle.
  • Sequence similarities

    Belongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic calponin antibody
    • Calponin 1 antibody
    • Calponin 1 basic smooth muscle antibody
    • Calponin H1 antibody
    • Calponin H1 smooth muscle antibody
    • Calponin-1 antibody
    • Calponin1 antibody
    • Calponins basic antibody
    • CNN 1 antibody
    • Cnn1 antibody
    • CNN1_HUMAN antibody
    • Epididymis secretory protein Li 14 antibody
    • HEL S 14 antibody
    • Sm Calp antibody
    • SMCC antibody
    • smooth muscle antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human uterus tissue stained for Calponin 1 using ab233854 at 1 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human breast carcinoma tissue stained for Calponin 1 using ab233854 at 1 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat uterus tissue stained for Calponin 1 using ab233854 at 1 µg/ml in immunohistochemical analysis.

References

ab233854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up