Overview

  • Product name

  • Description

    Rabbit polyclonal to Calponin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Calponin 2 aa 1-269. EXpressed in E.coli.
    Sequence:

    MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF QKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGM NPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQ ERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPP MDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMG YTQGANQSGQVFGLGRQIY


    Database link: Q99439

  • Positive control

    • WB: Recombinant human Calponin 2 protein; Human lung lysate; Pig lymph node lysate; HeLa and HepG2 cell lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 20 µg/ml. Predicted molecular weight: 34 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificity

    Heart and smooth muscle.
  • Sequence similarities

    Belongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calponin 2 antibody
    • Calponin H2 antibody
    • Calponin H2, smooth muscle antibody
    • Calponin-2 antibody
    • Cnn2 antibody
    • CNN2_HUMAN antibody
    • Neutral calponin antibody
    • smooth muscle antibody
    see all

Images

  • Anti-Calponin 2 antibody (ab233204) at 2 µg/ml + Recombinant human Calponin 2 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 34 kDa

  • All lanes : Anti-Calponin 2 antibody (ab233204) at 2 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 4 : Pig lymph node lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 34 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Calponin 2 (green) using ab233204 at 20 μg/ml in ICC/IF. FITC labeling.

References

ab233204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up