Overview

  • Product name

    Anti-Calponin 3 antibody - C-terminal
    See all Calponin 3 primary antibodies
  • Description

    Rabbit polyclonal to Calponin 3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Calponin 3 aa 270-329 (C terminal).
    Sequence:

    PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRD YQYSDQGIDY


    Database link: Q15417

  • Positive control

    • Human small intestine tissue, RT-4 & U-251 MG cell lysates, U-2 OS cell line

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 36 kDa.

Target

  • Function

    Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificity

    Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
  • Sequence similarities

    Belongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acidic calponin 3 antibody
    • acidic isoform antibody
    • Calponin 3 acidic antibody
    • Calponin 3 antibody
    • Calponin acidic antibody
    • Calponin acidic isoform antibody
    • Calponin antibody
    • Calponin-3 antibody
    • Calponin3 antibody
    • CNN 3 antibody
    • Cnn3 antibody
    • CNN3_HUMAN antibody
    • dJ639P13.2.2 antibody
    • OTTHUMP00000012470 antibody
    • OTTHUMP00000012471 antibody
    see all

Images

  • All lanes : Anti-Calponin 3 antibody - C-terminal (ab204365) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 36 kDa

  • Immunofluorescence analysis of U-2 OS cells labeling Calponin 3 with ab204365 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling Calponin 3 with ab204365 at 1/1000 dilution.

References

ab204365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up